PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 417aa    MW: 47093.4 Da    PI: 4.6519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622107.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
   XP_009622107.1 14 RGRWTAEEDEILTKYIQTNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding54.82.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T eE+++++++++ lG++ W++Ia++++ gRt++++k++w+++l
   XP_009622107.1  67 RGNITSEEEDIIIKLHATLGNR-WSLIAAHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.897961IPR017930Myb domain
SuperFamilySSF466891.54E-2811108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-211568IPR009057Homeodomain-like
CDDcd001671.59E-81661No hitNo description
PROSITE profilePS5129425.8762116IPR017930Myb domain
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2569116IPR009057Homeodomain-like
CDDcd001677.69E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDEILTKYIQ TNGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRSDLRRGNI TSEEEDIIIK LHATLGNRWS LIAAHLPGRT DNEIKNYWNS HLSRKVESLR  120
IPSDEKLPQA VVDLAKKGTL NPIKCRVGKT SRPSVKKNKT FKKSSSSLSE PKQPKESSEP  180
LNSTVPMPST PNMEKEALSS TISSWLEGNN VMDSMQEEVA NVAAPNPWSG SREAQSSLSS  240
DSGMEWLEEI MPMVIADQDM DPNEFILTYL DNGQGESPEK VTNEAENNCG TTNRINERNN  300
KDHVNKMVSS ENTQLESSPE SETVSINILK DVQENSNESK LLMEDSTVEW DWQEIADDMR  360
EVWSWEETGQ DNMLINHSWP LWDNTGTEFT NEITVEMDSV LHSENPNHSA LVAWLLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00598PBMTransfer from AT5G49330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622107.10.0PREDICTED: transcription factor MYB12-like
TrEMBLM1AI581e-132M1AI58_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233221e-132(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.19e-76myb domain protein 111